PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g054730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 431aa    MW: 48557.2 Da    PI: 9.0714
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g054730.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B362.37.7e-2071159595
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     ++++++l+ + l+lp +f+++ g++k    +++l+d +g+sWe++l+y+k+s+++++++GW++F+++ g k+g +++F+l++ + ++++++
  Csa07g054730.1  71 FVTASNLEADALYLPQDFTSSSGLPKFF-CKVVLTDGRGNSWELELRYDKSSNSFYMSRGWRHFCDELGKKVGSVFTFELMK-EWGTPFLS 159
                     56888999999********999999755.6*************************************************998.77777766 PP

2B336.96.5e-12178275198
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE....EEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr....yvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                     f++  ++ d+lk++rl+lp   ++++g++  es+ +tl  ++g +   +l  r +sgr      l+k W+eF+ an+L++g+ ++++ ++ ++++
  Csa07g054730.1 178 FVTLNLSYDSLKNCRLYLPSGNMRRNGLD--ESRLVTLLGKDGTRTIANLV-RETSGRnfgrLSLGKAWREFALANNLEVGENFTLECIW-ENAT 268
                     5566677899*******************..5679********88888884.444444456699***********************999.7777 PP

                     .EEEEE- CS
              B3  92 lvvkvfr 98 
                     + +++ +
  Csa07g054730.1 269 PILRLSD 275
                     8777765 PP

3B337.93.2e-12336423697
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     +++dv +   l lp +f++++g++   + ++ l  ++  +W   l    ++g +  + GW++F++ang+k gD++ ++++++ +  +v++++
  Csa07g054730.1 336 LHEDVKAYT-LFLPSQFMKANGIDILFG-KILLLGRKESEWCGCL--LSRDGNVSVGYGWRNFCEANGVKIGDSFSLEFKHNVDNIPVLQFR 423
                     566777776.9**********8887665.9***************..89999999***********************99986665666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.109.7E-1964162IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.04E-1964163IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.01567164IPR003340B3 DNA binding domain
CDDcd100172.97E-1667152No hitNo description
SMARTSM010191.3E-2268164IPR003340B3 DNA binding domain
PfamPF023621.3E-1871160IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.1E-11176272IPR015300DNA-binding pseudobarrel domain
CDDcd100171.70E-8177275No hitNo description
SMARTSM010191.1E-12178277IPR003340B3 DNA binding domain
SuperFamilySSF1019369.61E-12178271IPR015300DNA-binding pseudobarrel domain
PfamPF023621.0E-10178275IPR003340B3 DNA binding domain
PROSITE profilePS5086310.066178277IPR003340B3 DNA binding domain
PROSITE profilePS5086310.743330425IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.4E-12331425IPR015300DNA-binding pseudobarrel domain
SMARTSM010194.2E-10331426IPR003340B3 DNA binding domain
SuperFamilySSF1019361.8E-13332424IPR015300DNA-binding pseudobarrel domain
CDDcd100171.74E-9334410No hitNo description
PfamPF023623.1E-10339423IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MLRVSACDVR QLPSPTNSDH NKTVNTSKKH QRPTEEGGDV QENAVLVRAK RGRKTKSIPE  60
ESWDNSSFFA FVTASNLEAD ALYLPQDFTS SSGLPKFFCK VVLTDGRGNS WELELRYDKS  120
SNSFYMSRGW RHFCDELGKK VGSVFTFELM KEWGTPFLSF SPSKATLCYE TSENLDHFVT  180
LNLSYDSLKN CRLYLPSGNM RRNGLDESRL VTLLGKDGTR TIANLVRETS GRNFGRLSLG  240
KAWREFALAN NLEVGENFTL ECIWENATPI LRLSDTKPRR YIKRGPKPKF SGFCKKVSAS  300
SAAKDGKERE KGKNIEEPIN EASLIENHLL VILPLLHEDV KAYTLFLPSQ FMKANGIDIL  360
FGKILLLGRK ESEWCGCLLS RDGNVSVGYG WRNFCEANGV KIGDSFSLEF KHNVDNIPVL  420
QFRPKLRSGE *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010417231.10.0PREDICTED: B3 domain-containing protein REM-like 2
TrEMBLD7LIB91e-124D7LIB9_ARALL; Putative uncharacterized protein
STRINGscaffold_400529.11e-124(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78281641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24696.11e-109B3 family protein